Protein Info for HEPCGN_23515 in Escherichia coli ECOR38

Name: rutC
Annotation: pyrimidine utilization protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03610: pyrimidine utilization protein C" amino acids 1 to 127 (127 residues), 249.6 bits, see alignment E=2.7e-79 PF01042: Ribonuc_L-PSP" amino acids 13 to 126 (114 residues), 119.6 bits, see alignment E=3.9e-39

Best Hits

Swiss-Prot: 100% identical to RUTC_ECOS5: Putative aminoacrylate peracid reductase RutC (rutC) from Escherichia coli O150:H5 (strain SE15)

KEGG orthology group: K09021, UPF0076 protein RutC (inferred from 100% identity to eco:b1010)

MetaCyc: 100% identical to 3-aminoacrylate deaminase (Escherichia coli K-12 substr. MG1655)
RXN0-6452

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>HEPCGN_23515 pyrimidine utilization protein C (Escherichia coli ECOR38)
MPKSVIIPAGSSAPLAPFVPGTLADGVVYVSGTLAFDQHNNVLFADDPKAQTRHVLETIR
KVIETAGGTMADVTFNSIFITDWKNYAAINEIYAEFFPGDKPARFCIQCGLVKPDALVEI
ATIAHIAK