Protein Info for HEPCGN_23500 in Escherichia coli ECOR38
Name: rutF
Annotation: malonic semialdehyde reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RUTF_ECOBD: FMN reductase (NADH) RutF (rutF) from Escherichia coli (strain B / BL21-DE3)
KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 99% identity to eco:b1007)MetaCyc: 99% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]
Predicted SEED Role
"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- dibenzothiophene desulfurization (1/5 steps found)
- bacterial bioluminescence (3/8 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Methane metabolism
- Tryptophan metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.5.1.-
Use Curated BLAST to search for 1.5.1.- or 1.5.1.42
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (164 amino acids)
>HEPCGN_23500 malonic semialdehyde reductase (Escherichia coli ECOR38) MNIVDQQTFRDAMSCMGAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVW PVFNENRTLCVNTLSAGQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCR ISQVVSVGTHDILFCAIEAIHRHATPYGLVWFDRSYHALMRPAC