Protein Info for HEPCGN_23395 in Escherichia coli ECOR38

Name: appB
Annotation: cytochrome d ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 61 to 72 (12 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 122 to 148 (27 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 1 to 378 (378 residues), 656 bits, see alignment E=1e-201 PF02322: Cyt_bd_oxida_II" amino acids 7 to 361 (355 residues), 321.9 bits, see alignment E=2.3e-100

Best Hits

Swiss-Prot: 100% identical to APPB_ECOLI: Cytochrome bd-II ubiquinol oxidase subunit 2 (appB) from Escherichia coli (strain K12)

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to eco:b0979)

MetaCyc: 100% identical to cytochrome bd-II subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>HEPCGN_23395 cytochrome d ubiquinol oxidase subunit II (Escherichia coli ECOR38)
MFDYETLRFIWWLLIGVILVVFMISDGFDMGSGCLLPLVARNDDERRIVINSVGAHWEGN
QVWLILAGGALFAAWPRVYAAAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWD
AGLVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGSFWQLLTPFPLLCGLLSLGMV
ILQGGVWLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWLWVGIDGFVLLAQDANGPS
NPLMKLVAVLPGAWMNNFVESPVLWIFPLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFG
VIFTAGITLFPFVMPSSVSPISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYYK
MWGRMTTETLRRNENELY