Protein Info for HEPCGN_22840 in Escherichia coli ECOR38

Name: yohK
Annotation: CidB/LrgB family autolysis modulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 135 to 165 (31 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details TIGR00659: TIGR00659 family protein" amino acids 2 to 226 (225 residues), 366 bits, see alignment E=3.4e-114 PF04172: LrgB" amino acids 12 to 224 (213 residues), 273.7 bits, see alignment E=4.8e-86

Best Hits

Swiss-Prot: 100% identical to YOHK_SHIFL: Inner membrane protein YohK (yohK) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b2142)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>HEPCGN_22840 CidB/LrgB family autolysis modulator (Escherichia coli ECOR38)
MMANIWWSLPLTLIVFFAARKLAARYKFPLLNPLLVAMVVIIPFLMLTGISYDSYFKGSE
VLNDLLQPAVVALAYPLYEQLHQIRARWKSIITICFIGSVVAMVTGTSVALLMGASPEIA
ASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIRTKAARGLA
MGTASHALGTARCAELDYQEGAFSSLALVLCGIITSLIAPFLFPIILAVMG