Protein Info for HEPCGN_22720 in Escherichia coli ECOR38

Name: psuG
Annotation: pseudouridine-5'-phosphate glycosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF04227: Indigoidine_A" amino acids 16 to 306 (291 residues), 439 bits, see alignment E=4.1e-136

Best Hits

Swiss-Prot: 98% identical to PSUG_ECOLI: Pseudouridine-5'-phosphate glycosidase (psuG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b2165)

MetaCyc: 98% identical to pseudouridine-5'-phosphate glycosidase (Escherichia coli K-12 substr. MG1655)
Pseudouridylate synthase. [EC: 4.2.1.70]

Predicted SEED Role

"Pseudouridine 5'-phosphate glycosidase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>HEPCGN_22720 pseudouridine-5'-phosphate glycosidase (Escherichia coli ECOR38)
MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPFPQNAQTAIEVEETIRKQGA
VPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPFVVAAGKNGATTVASTMIIA
ALAGIKVFATGGIGGVHHGAEHTFDISADLQELANTNVTVVCAGAKSILDLGLTTEYLET
FGVPLIGYQTKALPAFFCRTSPFEVSIRLDSATEIARAMAVKWQSGLNGGLVVANPIPEQ
FAMPEESINAAIDQAVAEAEEQGVIGKESTPFLLARVAELTGGDSLKSNIQLVFNNAILA
SEIAKEYQRLAG