Protein Info for HEPCGN_22420 in Escherichia coli ECOR38

Name: atoA
Annotation: acetate CoA-transferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR02428: 3-oxoacid CoA-transferase, B subunit" amino acids 3 to 204 (202 residues), 306.5 bits, see alignment E=3.7e-96 PF01144: CoA_trans" amino acids 5 to 189 (185 residues), 153.6 bits, see alignment E=2.7e-49

Best Hits

Swiss-Prot: 100% identical to ATOA_ECOLI: Acetate CoA-transferase subunit beta (atoA) from Escherichia coli (strain K12)

KEGG orthology group: K01035, acetate CoA-transferase beta subunit [EC: 2.8.3.8] (inferred from 100% identity to eco:b2222)

MetaCyc: 100% identical to acetyl-CoA:acetoacetyl-CoA transferase subunit beta (Escherichia coli K-12 substr. MG1655)
Butyrate--acetoacetate CoA-transferase. [EC: 2.8.3.9]

Predicted SEED Role

"Acetyl-CoA:acetoacetyl-CoA transferase, beta subunit (EC 2.8.3.8)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 2.8.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.8

Use Curated BLAST to search for 2.8.3.8 or 2.8.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>HEPCGN_22420 acetate CoA-transferase subunit beta (Escherichia coli ECOR38)
MDAKQRIARRVAQELRDGDIVNLGIGLPTMVANYLPEGIHITLQSENGFLGLGPVTTAHP
DLVNAGGQPCGILPGAAMFDSAMSFALIRGGHIDACVLGGLQVDEEANLANWVVPGKMVP
GMGGAMDLVTGSRKVIIAMEHCAKDGSAKILRRCTMPLTAQHAVHMLVTELAVFRFIDGK
MWLTEIADGCDLATVRAKTEARFEVAADLNTQRGDL