Protein Info for HEPCGN_21945 in Escherichia coli ECOR38

Name: rpnB
Annotation: recombination-promoting nuclease RpnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF04754: Transposase_31" amino acids 8 to 209 (202 residues), 311.1 bits, see alignment E=1.7e-97 TIGR01784: conserved hypothetical protein" amino acids 9 to 295 (287 residues), 191 bits, see alignment E=1.9e-60

Best Hits

Swiss-Prot: 94% identical to RPNB_ECOLI: Recombination-promoting nuclease RpnB (rpnB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_2454)

MetaCyc: 71% identical to recombination-promoting nuclease RpnA (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>HEPCGN_21945 recombination-promoting nuclease RpnB (Escherichia coli ECOR38)
MTISTTSTPHDAVFKSFLRHPDTARDFIDIHLPAPLRKLCDLTTLKLEPNSFIDEDLRQY
YSDLLWSVKTQEGAGYIYVVIEHQSKPEELMAFRMMRYSIAAMQNHLDAGYKELPLVIPM
LFYHGCRSPYPYSLCWLDEFAEPAIARKIYSSAFPLVDITVVPDDEIMQHRKMALLELIQ
KHIRQRDLLGLVDQIVSLLVTGNTNDRQLKALFNYVLQTGDAQRFRAFIGEIAERAPQEK
EKLMTIADRLREEGRNDGLILGKREEALRIAQEMLERGLDRELVLTLTRLSPEELLNQKQ