Protein Info for HEPCGN_21570 in Escherichia coli ECOR38

Name: ypdB
Annotation: two-component system response regulator YpdB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 85.6 bits, see alignment E=2.8e-28 PF04397: LytTR" amino acids 147 to 243 (97 residues), 116.6 bits, see alignment E=5e-38

Best Hits

Swiss-Prot: 99% identical to YPDB_ECOL6: Transcriptional regulatory protein YpdB (ypdB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 100% identity to ecc:c2920)

Predicted SEED Role

"Hypothetical response regulatory protein ypdB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>HEPCGN_21570 two-component system response regulator YpdB (Escherichia coli ECOR38)
VKVIIVEDEFLAQQELSWLIKEHSQMEIVGTFDDGLDVLKFLQHNRVDAIFLDINIPSLD
GVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRITGMLQKLEAAWQ
QQQTSSTTPAATVTRENDTINLVKDERIIVTPINDIYYAEAHEKMTFVYTRRESYVMPMN
ITEFCSKLPPSHFFRCHRSFCVNLNKIREIEPWFNNTYILRLKDLDFEVPVSRSKVKEFR
QLMHL