Protein Info for HEPCGN_21560 in Escherichia coli ECOR38

Annotation: PTS transporter subunit EIIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 TIGR00848: PTS system, fructose subfamily, IIA component" amino acids 16 to 117 (102 residues), 120.4 bits, see alignment E=2.3e-39 PF00359: PTS_EIIA_2" amino acids 20 to 131 (112 residues), 92.7 bits, see alignment E=1e-30

Best Hits

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)" in subsystem Fructose and Mannose Inducible PTS or Fructose utilization or Mannitol Utilization (EC 2.7.3.9)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>HEPCGN_21560 PTS transporter subunit EIIA (Escherichia coli ECOR38)
LKRYSPPLRRKKTFAHLGVNGRTEHPFELEEDVWQREEIVTTGVGFGVAIPHTKSQWIRH
SSISIARLVKPVDWQSEMGEVELVIMLTLGANEGMNHVKVFSQLARKLVNKNFRQSLFAA
QDAQSILTLLETELTF