Protein Info for HEPCGN_21535 in Escherichia coli ECOR38

Name: fryB
Annotation: PTS system fructose-like EIIB component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 6 to 90 (85 residues), 91.9 bits, see alignment E=1.3e-30 PF02302: PTS_IIB" amino acids 7 to 98 (92 residues), 71 bits, see alignment E=5.4e-24

Best Hits

Swiss-Prot: 100% identical to PTFB1_ECOLI: PTS system fructose-like EIIB component 1 (fryB) from Escherichia coli (strain K12)

KEGG orthology group: K11202, PTS system, fructose-specific IIB-like component [EC: 2.7.1.69] (inferred from 100% identity to eco:b2387)

MetaCyc: 46% identical to putative PTS enzyme IIB component FrwB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>HEPCGN_21535 PTS system fructose-like EIIB component 1 (Escherichia coli ECOR38)
MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATI
IIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIASEQQ