Protein Info for HEPCGN_21385 in Escherichia coli ECOR38

Name: cysZ
Annotation: sulfate transporter CysZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 209 to 241 (33 residues), see Phobius details PF07264: EI24" amino acids 15 to 231 (217 residues), 210.1 bits, see alignment E=1.9e-66

Best Hits

Swiss-Prot: 100% identical to CYSZ_ECO7I: Sulfate transporter CysZ (cysZ) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K06203, CysZ protein (inferred from 100% identity to eco:b2413)

MetaCyc: 100% identical to sulfate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-586

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>HEPCGN_21385 sulfate transporter CysZ (Escherichia coli ECOR38)
MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT
LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP
PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA
IQYCDYPFDNHKVPFKEMRIALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM
WVDCYRDKHAMWR