Protein Info for HEPCGN_21305 in Escherichia coli ECOR38

Name: murP
Annotation: PTS N-acetylmuramic acid transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 120 to 144 (25 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 301 to 325 (25 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 441 to 467 (27 residues), see Phobius details PF00367: PTS_EIIB" amino acids 13 to 44 (32 residues), 46.9 bits, see alignment (E = 1.5e-16) PF02378: PTS_EIIC" amino acids 120 to 401 (282 residues), 162.9 bits, see alignment E=1e-51

Best Hits

Swiss-Prot: 99% identical to PTYBC_ECOLI: PTS system N-acetylmuramic acid-specific EIIBC component (murP) from Escherichia coli (strain K12)

KEGG orthology group: K11191, PTS system, N-acetylmuramic acid-specific IIB component [EC: 2.7.1.69] K11192, PTS system, N-acetylmuramic acid-specific IIC component (inferred from 100% identity to ect:ECIAI39_2574)

MetaCyc: 99% identical to N-acetylmuramic acid-specific PTS enzyme IICB component / anhydro-N-acetylmuramic acid transporter (Escherichia coli K-12 substr. MG1655)
RXN0-17 [EC: 2.7.1.192]; TRANS-RXN0-587 [EC: 2.7.1.192]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.192 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>HEPCGN_21305 PTS N-acetylmuramic acid transporter subunit IIBC (Escherichia coli ECOR38)
MAKEISSELLNTILTRVGGPGNIASCGNCMTRLRLGVHDSSLVDPNIKTLEGVKGVILTS
DQVQVVFGPGKAHRAAKAMSELLGEAPVQDAAEIAAQNKRQLKAKQTSGVQQFLAKFATI
FTPLIPGFIAAGLLLGIATLIATVMHVPADAQGTLPDALNFMKVFSKGLFTFLVILVGYN
AAQAFGGTGVNGAIIAALFLLGYNPTATTGYYAGFHDFFGLPIDPRGNIIGVLITAWACA
RIECMVHRFMPDDLDMLLTSLITLLITATLAYLIIMPLGGWLFEGMSWLFMHLNSNPLGC
AVLAGLFLIAVVFGVHQGFIPVYLALMDSQGFNSLFPILSMAGAGQVGAALALYWRAQPH
SALRSQVRGAIIPGLLGVGEPLIYGVTLPRMKPFVTACLGGAAGGLFIGLIAWWGLPMGL
NSAFGPSGLVALPLMTSAQGILPAMAVYAGGILVAWVCGFIFTTLFGCRNVNLD