Protein Info for HEPCGN_20985 in Escherichia coli ECOR38

Name: uraA
Annotation: uracil permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 159 to 176 (18 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 11 to 405 (395 residues), 437.1 bits, see alignment E=3.4e-135 PF00860: Xan_ur_permease" amino acids 16 to 383 (368 residues), 372.5 bits, see alignment E=1e-115

Best Hits

Swiss-Prot: 100% identical to URAA_ECOLI: Uracil permease (uraA) from Escherichia coli (strain K12)

KEGG orthology group: K02824, uracil permease (inferred from 100% identity to eco:b2497)

MetaCyc: 100% identical to uracil:H+ symporter UraA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-132

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>HEPCGN_20985 uracil permease (Escherichia coli ECOR38)
MTRRAIGVSERPPLLQTIPLSLQHLFAMFGATVLVPVLFHINPATVLLFNGIGTLLYLFI
CKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLVSFIVKKAGTGWLDVLF
PPAAMGAIVAVIGLELAGVAAGMAGLLPAEGQTPDSKTIIISITTLAVTVLGSVLFRGFL
AIIPILIGVLVGYALSFAMGIVDTTPIINAHWFALPTLYTPRFEWFAILTILPAALVVIA
EHVGHLVVTANIVKKDLLRDPGLHRSMFANGLSTVISGFFGSTPNTTYGENIGVMAITRV
YSTWVIGGAAIFAILLSCVGKLAAAIQMIPLPVMGGVSLLLYGVIGASGIRVLIESKVDY
NKAQNLILTSVILIIGVSGAKVNIGAAELKGMALATIVGIGLSLVFKLISVLRPEEVVLD
AEDADITDK