Protein Info for HEPCGN_20880 in Escherichia coli ECOR38

Name: sinH
Annotation: intimin-like inverse autotransporter SinH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF11924: IAT_beta" amino acids 1 to 171 (171 residues), 249.3 bits, see alignment E=2.9e-78

Best Hits

KEGG orthology group: K13735, adhesin/invasin (inferred from 89% identity to ecq:ECED1_2940)

Predicted SEED Role

"adherence and invasion outermembrane protein (Inv,enhances Peyer's patches colonization)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>HEPCGN_20880 intimin-like inverse autotransporter SinH (Escherichia coli ECOR38)
LGGNIFYDYDFTRGHRRLGLGAEAWTDYLKFSGNYYHPLSDWKDSEDFDFYEERPARGWD
IRAEAWLPAYPQLGGKIVFEQYYGNEVALFGTDNLEKDPFAVTLGVKYQPVPLIAVGTDF
KAGTGDNTDLSVNATLNYQFGVPLKDQLDPDKVSAAHSLMGSRHDFVERNNFIVLEYKEK
DPLDVTLWLKADATNEHPECVIKDTPEEAIGLEKCKWTINALINHHYKIVAASWQAKNNA
ARTLVMPVIKENTLTEGNNNHWNLVLPAWQYSSDKAEQEKLNTWRVRLALEDEKGNRQNS
GVVEITVQQDRKIELIVNNIADVPDENNHSHEASAQADGVDGVVMDLDITDSFGDNTDRN
GNVLPQDNLNPQLFDANDKKVTLTNKPCTTETPCVFIAKQDKEKGTVTLSSTLPGTFRWK
AKAAPYDDSNYVDVTFLGSDIGGLNAFIYRVGAAKPVNLIGNKEPLPLNSSYRFVLWRDA
NKDGVFQLSEKLTEEEMKQYDYQWEFTGHSVNGNTGAQANTTNADIEIPATNKDAATKFS
AQVTDGVQGYGLQVNYSKK