Protein Info for HEPCGN_20710 in Escherichia coli ECOR38

Name: hcaC
Annotation: bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00355: Rieske" amino acids 3 to 89 (87 residues), 70 bits, see alignment E=1.3e-23 PF13806: Rieske_2" amino acids 8 to 99 (92 residues), 43.6 bits, see alignment E=2.6e-15

Best Hits

Swiss-Prot: 100% identical to HCAC_SHIFL: 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit (hcaC) from Shigella flexneri

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 100% identity to eco:b2540)

MetaCyc: 100% identical to putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin subunit (Escherichia coli K-12 substr. MG1655)
3-phenylpropanoate dioxygenase. [EC: 1.14.12.19]; 1.14.12.19 [EC: 1.14.12.19]

Predicted SEED Role

"3-phenylpropionate dioxygenase ferredoxin subunit" in subsystem Cinnamic Acid Degradation or Phenylpropionate Degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19

Use Curated BLAST to search for 1.14.12.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>HEPCGN_20710 bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit (Escherichia coli ECOR38)
MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATV
ECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP