Protein Info for HEPCGN_20465 in Escherichia coli ECOR38
Name: ung
Annotation: uracil-DNA glycosylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to UNG_ECO7I: Uracil-DNA glycosylase (ung) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)
KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 99% identity to eco:b2580)MetaCyc: 99% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]
Predicted SEED Role
"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision
Isozymes
Compare fitness of predicted isozymes for: 3.2.2.-
Use Curated BLAST to search for 3.2.2.- or 3.2.2.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (229 amino acids)
>HEPCGN_20465 uracil-DNA glycosylase (Escherichia coli ECOR38) MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVI LGQDPYHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVL LLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHRKGVVFLLWGSHAQKKGAIIDKQRH HVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMPVLPAESE