Protein Info for HEPCGN_19965 in Escherichia coli ECOR38
Name: luxS
Annotation: S-ribosylhomocysteine lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to LUXS_ECO7I: S-ribosylhomocysteine lyase (luxS) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)
KEGG orthology group: K07173, S-ribosylhomocysteine lyase [EC: 4.4.1.21] (inferred from 99% identity to eco:b2687)MetaCyc: 99% identical to S-ribosylhomocysteine lyase (Escherichia coli K-12 substr. MG1655)
S-ribosylhomocysteine lyase. [EC: 4.4.1.21]
Predicted SEED Role
"S-ribosylhomocysteine lyase (EC 4.4.1.21) / Autoinducer-2 production protein LuxS" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.21)
MetaCyc Pathways
- S-adenosyl-L-methionine salvage I (4/4 steps found)
- autoinducer AI-2 biosynthesis II (Vibrio) (5/6 steps found)
- autoinducer AI-2 biosynthesis I (4/5 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.4.1.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (171 amino acids)
>HEPCGN_19965 S-ribosylhomocysteine lyase (Escherichia coli ECOR38) MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQI PELNVYQCGTYQMHSLQEAQGIARNILERDVRINSNEELALPKEKLQELHI