Protein Info for HEPCGN_19765 in Escherichia coli ECOR38
Name: hycB
Annotation: formate hydrogenlyase subunit HycB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to HYCB_SHIFL: Formate hydrogenlyase subunit 2 (hycB) from Shigella flexneri
KEGG orthology group: None (inferred from 98% identity to eco:b2724)MetaCyc: 98% identical to hydrogenase 3 iron-sulfur protein HycB (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]
Predicted SEED Role
"Formate hydrogenlyase subunit 2" in subsystem Formate hydrogenase
MetaCyc Pathways
- mixed acid fermentation (16/16 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
- hydrogen production III (1/1 steps found)
- hydrogen production V (1/1 steps found)
- hydrogen production VIII (1/1 steps found)
- hydrogen production VI (1/2 steps found)
- superpathway of hydrogen production (1/2 steps found)
- superpathway of photosynthetic hydrogen production (3/6 steps found)
- L-glutamate degradation VII (to butanoate) (7/12 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.12.7.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (203 amino acids)
>HEPCGN_19765 formate hydrogenlyase subunit HycB (Escherichia coli ECOR38) VNRFVIADSTLCIGCHTCEAACSETHRQYGLQSMPRLRVMLNEKESAPQLCHHCEDAPCA TVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAP PAPARVSTLLDWVPGIRAIAVKCDLCSFDEQGPACVRMCPTKALHLVDNTDIARVSKRKR ELTFNTDFGDLTLFQQAQSGEAK