Protein Info for HEPCGN_19755 in Escherichia coli ECOR38

Name: hypA
Annotation: hydrogenase maturation nickel metallochaperone HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01155: HypA
  • amino acids 1 to 113 (113 residues), 107 bits, E=2.8e-35
• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 116 (116 residues), 147.8 bits, E=6.6e-48

Best Hits

Swiss-Prot: 100% identical to HYPA_ECOLI: Hydrogenase maturation factor HypA (hypA) from Escherichia coli (strain K12)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to eco:b2726)

MetaCyc: 100% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (9/10 steps found)

Protein Sequence (116 amino acids)

>HEPCGN_19755 hydrogenase maturation nickel metallochaperone HypA (Escherichia coli ECOR38)
MHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVETSSLAFCFDLVCRGSVAEGC
KLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQIVADDGLQIRRIEIDQE