Protein Info for HEPCGN_19745 in Escherichia coli ECOR38

Name: hypC
Annotation: hydrogenase 3 maturation protein HypC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 TIGR00074: hydrogenase assembly chaperone HypC/HupF" amino acids 1 to 84 (84 residues), 112.2 bits, see alignment E=4e-37 PF01455: HupF_HypC" amino acids 1 to 71 (71 residues), 88 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 100% identical to HYPC_ECOLI: Hydrogenase maturation factor HypC (hypC) from Escherichia coli (strain K12)

KEGG orthology group: K04653, hydrogenase expression/formation protein HypC (inferred from 100% identity to eco:b2728)

MetaCyc: 100% identical to hydrogenase maturation factor HypC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypC" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (90 amino acids)

>HEPCGN_19745 hydrogenase 3 maturation protein HypC (Escherichia coli ECOR38)
MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVIN
EAEARDTLDALQNMFDVEPDVGALLYGEEK