Protein Info for HEPCGN_19685 in Escherichia coli ECOR38

Name: ecdB
Annotation: putative UbiX-like flavin prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02441: Flavoprotein
  • amino acids 1 to 173 (173 residues), 148.6 bits, E=6.4e-48
• TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases
  • amino acids 2 to 183 (182 residues), 245.4 bits, E=1.6e-77

Best Hits

Swiss-Prot: 98% identical to PADL_ECOLX: Probable UbiX-like flavin prenyltransferase (ecdB) from Escherichia coli

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 98% identity to ece:Z4047)

MetaCyc: 86% identical to protocatechuate/4-hydroxybenzoate decarboxylase accessory subunit (Klebsiella pneumoniae pneumoniae)
Protocatechuate decarboxylase. [EC: 4.1.1.63]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.63

Protein Sequence (197 amino acids)

>HEPCGN_19685 putative UbiX-like flavin prenyltransferase (Escherichia coli ECOR38)
MRLIVGMTGATGAPLGVALLQALREMPNVETHLVMSKWARTTIELETPYSARDVAALADF
SHNPADQAATISSGSFRTDGMIVIPCSMKTLAGIRAGYADGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAMVPPMPAFYNHPATVDDIVHHVVARVLDQFGLEHPHA
RRWQGLPQARNFSQENE