Protein Info for HEPCGN_19675 in Escherichia coli ECOR38

Name: rpoS
Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 48 to 328 (281 residues), 480.5 bits, see alignment E=1.9e-148 PF00140: Sigma70_r1_2" amino acids 56 to 88 (33 residues), 44.3 bits, see alignment 2.9e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 90 to 317 (228 residues), 118.4 bits, see alignment E=2.5e-38 PF04542: Sigma70_r2" amino acids 94 to 163 (70 residues), 80.6 bits, see alignment E=1.2e-26 PF04539: Sigma70_r3" amino acids 174 to 248 (75 residues), 74.9 bits, see alignment E=9e-25 PF04545: Sigma70_r4" amino acids 262 to 315 (54 residues), 55.3 bits, see alignment 7.5e-19

Best Hits

Swiss-Prot: 100% identical to RPOS_ECOLI: RNA polymerase sigma factor RpoS (rpoS) from Escherichia coli (strain K12)

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to eco:b2741)

MetaCyc: 100% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>HEPCGN_19675 RNA polymerase sigma factor RpoS (Escherichia coli ECOR38)
MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEEEPSDNDLAEEELLSQGATQRVLDATQL
YLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLI
EEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLR
TARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILAD
EKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRE
RVRQIQVEGLRRLREILQTQGLNIEALFRE