Protein Info for HEPCGN_19655 in Escherichia coli ECOR38

Name: truD
Annotation: tRNA pseudouridine(13) synthase TruD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00094: tRNA pseudouridine synthase, TruD family" amino acids 1 to 342 (342 residues), 354.2 bits, see alignment E=6.5e-110 PF01142: TruD" amino acids 8 to 167 (160 residues), 135.8 bits, see alignment E=9.9e-44 amino acids 188 to 337 (150 residues), 65.6 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 100% identical to TRUD_ECO7I: tRNA pseudouridine synthase D (truD) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 99% identity to eco:b2745)

MetaCyc: 99% identical to tRNA pseudouridine13 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11841 [EC: 5.4.99.27]

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12 or 5.4.99.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>HEPCGN_19655 tRNA pseudouridine(13) synthase TruD (Escherichia coli ECOR38)
MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVAD
ALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEIPDLSAFQLEGCQVLEYARHKRK
LRLGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQRFGIGGSNLQGALRWAQ
TNTPVRDRNKRSFWLSAARSALFNQIVAERLKKADVNQVVDGDALQLAGRGSWFVATTEE
LAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAAETELQALLVREKVEAARRA
MLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE