Protein Info for HEPCGN_19485 in Escherichia coli ECOR38

Name: gudD
Annotation: glucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR03247: glucarate dehydratase" amino acids 6 to 446 (441 residues), 896.5 bits, see alignment E=1.4e-274 PF13378: MR_MLE_C" amino acids 188 to 405 (218 residues), 159.4 bits, see alignment E=5.4e-51

Best Hits

Swiss-Prot: 99% identical to GUDD_ECO57: Glucarate dehydratase (gudD) from Escherichia coli O157:H7

KEGG orthology group: K01706, glucarate dehydratase [EC: 4.2.1.40] (inferred from 100% identity to ecm:EcSMS35_2925)

MetaCyc: 99% identical to D-glucarate dehydratase (Escherichia coli K-12 substr. MG1655)
5.1.2.-; Glucarate dehydratase. [EC: 4.2.1.40]

Predicted SEED Role

"Glucarate dehydratase (EC 4.2.1.40)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>HEPCGN_19485 glucarate dehydratase (Escherichia coli ECOR38)
MSSQFSTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTLVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDDQCDWYRLRHE
EAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAW
SLNEAIKIGTYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGLVQVPQKPGLGVEIDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR