Protein Info for HEPCGN_19475 in Escherichia coli ECOR38

Name: gudP
Annotation: galactarate/glucarate/glycerate transporter GudP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 414 to 436 (23 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 318 (294 residues), 168.7 bits, see alignment E=8.7e-54 TIGR00893: D-galactonate transporter" amino acids 27 to 436 (410 residues), 538.4 bits, see alignment E=5.3e-166

Best Hits

Swiss-Prot: 100% identical to GUDP_ECOLI: Probable glucarate transporter (gudP) from Escherichia coli (strain K12)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 100% identity to eco:b2789)

MetaCyc: 100% identical to galactarate/D-glucarate transporter GudP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>HEPCGN_19475 galactarate/glucarate/glycerate transporter GudP (Escherichia coli ECOR38)
MSSLSQAASSVEKRTNARYWIVVMLFIVTSFNYGDRATLSIAGSEMAKDIGLDPVGMGYV
FSAFSWAYVIGQIPGGWLLDRFGSKRVYFWSIFIWSMFTLLQGFVDIFSGFGIIVALFTL
RFLVGLAEAPSFPGNSRIVAAWFPAQERGTAVSIFNSAQYFATVIFAPIMGWLTHEVGWS
HVFFFMGGLGIVISFIWLKVIHEPNQHPGVNQKELEYIAAGGALINMDQQNTKVKVPFSV
KWGQIKQLLGSRMMIGVYIGQYCINALTYFFITWFPVYLVQARGMSILKAGFVASVPAVC
GFIGGVLGGIISDWLMRRTGSLNIARKTPIVMGMLLSMVMVFCNYVNVEWMIIGFMALAF
FGKGIGALGWAVMADTAPKEISGLSGGLFNMFGNISGIVTPIAIGYIVGTTGSFNGALIY
VGVHALIAVLSYLVLVGDIKRIELKPVAGQ