Protein Info for HEPCGN_18990 in Escherichia coli ECOR38

Name: xdhC
Annotation: xanthine dehydrogenase iron sulfur-binding subunit XdhC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF00111: Fer2" amino acids 12 to 68 (57 residues), 33.9 bits, see alignment E=2.5e-12 PF01799: Fer2_2" amino acids 78 to 152 (75 residues), 90.1 bits, see alignment E=8e-30

Best Hits

Swiss-Prot: 100% identical to XDHC_ECOLI: Putative xanthine dehydrogenase iron-sulfur-binding subunit XdhC (xdhC) from Escherichia coli (strain K12)

KEGG orthology group: K13480, xanthine dehydrogenase iron-sulfur-binding subunit (inferred from 100% identity to eco:b2868)

MetaCyc: 100% identical to putative xanthine dehydrogenase iron-sulfur-binding subunit XdhC (Escherichia coli K-12 substr. MG1655)
Xanthine dehydrogenase. [EC: 1.17.1.4]; 1.17.1.4 [EC: 1.17.1.4]

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>HEPCGN_18990 xanthine dehydrogenase iron sulfur-binding subunit XdhC (Escherichia coli ECOR38)
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK