Protein Info for HEPCGN_18835 in Escherichia coli ECOR38

Name: yqfA
Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details PF03006: HlyIII" amino acids 22 to 219 (198 residues), 133.9 bits, see alignment E=3.6e-43 TIGR01065: channel protein, hemolysin III family" amino acids 25 to 226 (202 residues), 241.5 bits, see alignment E=3.1e-76

Best Hits

Swiss-Prot: 100% identical to YQFA_ECO57: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O157:H7

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to eco:b2899)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>HEPCGN_18835 hemolysin III family protein (Escherichia coli ECOR38)
MCVYVSPEQVMVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLNASATA
ITSYSLYGGSMILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLLVGLDSP
LARGLMIVIWSLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKLAAGSVTL
LAVGGVVYSLGVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQA