Protein Info for HEPCGN_18280 in Escherichia coli ECOR38

Name: iucB
Annotation: N(6)-hydroxylysine O-acetyltransferase IucB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF13523: Acetyltransf_8" amino acids 149 to 294 (146 residues), 176.4 bits, see alignment E=1.4e-56

Best Hits

Swiss-Prot: 95% identical to IUCB_ECOLX: N(6)-hydroxylysine O-acetyltransferase (iucB) from Escherichia coli

KEGG orthology group: K03896, acetyl CoA:N6-hydroxylysine acetyl transferase [EC: 2.3.1.102] (inferred from 100% identity to eoi:ECO111_1294)

MetaCyc: 95% identical to N6-hydroxylysine O-acetyltransferase subunit (Escherichia coli K-12)
N(6)-hydroxylysine O-acetyltransferase. [EC: 2.3.1.102]

Predicted SEED Role

"N6-hydroxylysine O-acetyltransferase (EC 2.3.1.102), aerobactin biosynthesis protein IucB @ Siderophore synthetase small component, acetyltransferase" (EC 2.3.1.102)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>HEPCGN_18280 N(6)-hydroxylysine O-acetyltransferase IucB (Escherichia coli ECOR38)
MSEANIIHSRYGLRCEKLDKPLNLGWGLDNSAVLHCPGELPTGWLCDALDQIFIAAPQLS
AVALPWAEWREEPQALTLFGQVKSDIIHRTAFWQLPLWLSSPANRASGEMVFDAEREIYF
PQRPPRPQGEVYRRYDPRIRRMLSFRIADPVSDAERFTRWMNDPRVEYFWEQSGSLEVQT
AYLERQLTGKHAFPLIGCFDDRPFSYFEIYWAAEDRIGRHYSWQPFDRGLHLLVGEQQWR
GAHYVQSWLRGLTHYLLLDEPRTQRTVLEPRTDNQRLFRHLEPAGYRTIKEFDFPHKRSR
MVMADRHHFFTEVGL