Protein Info for HEPCGN_18160 in Escherichia coli ECOR38

Name: kpsE
Annotation: Capsule polysaccharide export inner-membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details TIGR01010: polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family" amino acids 24 to 382 (359 residues), 492.6 bits, see alignment E=3.6e-152

Best Hits

Swiss-Prot: 100% identical to KPSE5_ECOLX: Capsule polysaccharide export inner-membrane protein KpsE (kpsE) from Escherichia coli

KEGG orthology group: K10107, capsular polysaccharide transport system permease protein (inferred from 100% identity to ecp:ECP_3021)

Predicted SEED Role

"Capsular polysaccharide export system inner membrane protein KpsE" in subsystem Capsular Polysaccharide (CPS) of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>HEPCGN_18160 Capsule polysaccharide export inner-membrane protein (Escherichia coli ECOR38)
MLIKVKSAVSWMRARLSAISLADIQKHLAKIIILAPMAVLLIYLAIFSQPRYMSESKVAI
KRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLAALDKQLNFREAFSHSGLD
FLNHLSKDETAEGFLKYYKDRINVSYDDKTGLLNIQTQGFSPEFSLKFNQTVLKESERFI
NEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLM
GQKIQMEADLRNLLTYLREDAPQVVSARNAIQSLQAQIDEEKSKITAPQGDKLNRMAVDF
EEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVISSPQLPQESSFPNIPYLIACWL
LVCCLLFGTLKLLLAVIEDHRD