Protein Info for HEPCGN_18145 in Escherichia coli ECOR38

Name: kpsC
Annotation: Capsule polysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 PF05159: Capsule_synth" amino acids 37 to 299 (263 residues), 191.2 bits, see alignment E=1.6e-60 amino acids 367 to 457 (91 residues), 49.9 bits, see alignment E=1.7e-17 amino acids 470 to 620 (151 residues), 103 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 97% identical to KPSC5_ECOLX: Capsule polysaccharide export protein KpsC (kpsC) from Escherichia coli

KEGG orthology group: K07266, capsular polysaccharide export protein (inferred from 100% identity to ect:ECIAI39_3437)

Predicted SEED Role

"Capsular polysaccharide export system protein KpsC" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (675 amino acids)

>HEPCGN_18145 Capsule polysaccharide export protein (Escherichia coli ECOR38)
MIGIYSPGIWRIPHLEKFLAQPCQKLSLLRPVPQEVDAIAVWGHRPSAAKPVAIAKAAGK
PVIRLEDGFVRSLDLGVNGEPPLSLVVDDCGIYYDASKPSALEKLVQDKAGNTALISQAR
EAMHTIVTGDLSKYNLAPAFVADESERADIVLVVDQTFNDMSVTYGNAGPHEFAAMLEAA
MAENPQAEIWVKVHPDVLEGKKTGYFADLRATQRVRLIAENVSPQSLLRHVSQVYVVTSQ
YGFEALLAGKPVTCFGQPWYAGWGLTDDRHPQSALLSARRGSATLEELFAAAYLRYCRYI
DPQTGEVSDLFTVLQWLQLQRRHLQQRDGYLWAPGLTLWKSAILKPFLQTATNRLSFSRR
CTAASACVVWGVKGEQQWRAEAQRKSLPLWRMEDGFLRSSGLGSDLLPPLSLVLDKRGIY
YDATRPSDLEVLLNHSQLTLAQKMRAEKLRQRLVESKLSKYNLGADFSLPAEAKDKKVIL
VPGQVEDDASIKTGTVSIKSNLELLRTVRERNPHAYIVYKPHPDVLVGNRKGDIPAELTA
ELADYQALDADIIQCIQRADEVHTMTSLSGFEALLHGKHVHCYGLPFYSGWGLTVDEHRC
PRRERKLTLADLIYQALIVYPTYIHPTRLQPITVEEAAEYLIQTPRKPLFITRKKAGRVI
RYYRKLIMFCKVRFG