Protein Info for HEPCGN_18120 in Escherichia coli ECOR38

Name: neuA
Annotation: N-acylneuraminate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF02348: CTP_transf_3" amino acids 6 to 233 (228 residues), 97.9 bits, see alignment E=7.5e-32 PF13472: Lipase_GDSL_2" amino acids 270 to 407 (138 residues), 49.8 bits, see alignment E=6.2e-17

Best Hits

Swiss-Prot: 100% identical to NEUA_ECOLX: N-acylneuraminate cytidylyltransferase (neuA) from Escherichia coli

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 100% identity to ecm:EcSMS35_3231)

MetaCyc: 100% identical to cytidine 5'-monophosphate N-acetylneuraminate synthetase (Escherichia coli K1)
N-acylneuraminate cytidylyltransferase. [EC: 2.7.7.43]

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>HEPCGN_18120 N-acylneuraminate cytidylyltransferase (Escherichia coli ECOR38)
MRTKIIAIIPARSGSKGLRNKNALMLIDKPLLAYTIEAALQSEMFEKVIVTTDSEQYGAI
AESYGADFLLRPEELATDKASSFEFIKHALSIYTDYESFALLQPTSPFRDSTHIIEAVKL
YQTLEKYQCVVSVTRSNKPSQIIRPLDDYSTLSFFDLDYSKYNRNSIVEYHPNGAIFIAN
KQHYLHTKHFFGRYSLAYIMDKESSLDIDDRMDFELAITIQQKKNRQKILYQNIHNRINE
KRNEFDSVSDITLIGHSLFDYWDVKKINDIEVNNLGIAGINSKEYYEYIIEKELIVNFGE
FVFIFFGTNDIVVSDWKKEDTLWYLKKTCQYIKKKNAASKIYLLSVPPVFGRIDRDNRII
NDLNSYLRENVDFAKFISLDHVLKDSYGNLNKMYTYDGLHFNSNGYTVLENEIAEIVK