Protein Info for HEPCGN_18100 in Escherichia coli ECOR38

Name: kpsM
Annotation: Polysialic acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF01061: ABC2_membrane" amino acids 14 to 218 (205 residues), 57.5 bits, see alignment E=7.4e-20

Best Hits

Swiss-Prot: 100% identical to KPSM1_ECOLX: Polysialic acid transport protein KpsM (kpsM) from Escherichia coli

KEGG orthology group: K09688, capsular polysaccharide transport system permease protein (inferred from 100% identity to ecm:EcSMS35_3235)

Predicted SEED Role

"Capsular polysaccharide ABC transporter, permease protein KpsM" in subsystem Capsular Polysaccharide (CPS) of Campylobacter or Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>HEPCGN_18100 Polysialic acid transport protein (Escherichia coli ECOR38)
MARSGFEVQKVTVEALFLREIRTRFGKFRLGYLWAILEPSAHLLILLGILGYVMHRTMPD
ISFPVFLLNGLIPFFIFSSISKRSIGAIEANQGLFNYRPVKPIDTIIARALLETLIYVAV
YILLMLIVWMTGEYFEITNFLQLVLTWSLLIILSCGVGLIFMVVGKTFPEMQKVLPILLK
PLYFISCIMFPLHSIPKQYWSYLLWNPLVHVVELSREAVMPGYISEGVSLNYLAMFTLVT
LFIGLALYRTREEAMLTS