Protein Info for HEPCGN_18060 in Escherichia coli ECOR38

Name: gspF
Annotation: general secretion pathway protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 171 to 194 (24 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 326 to 340 (15 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 405 (402 residues), 490.3 bits, see alignment E=2.6e-151 PF00482: T2SSF" amino acids 72 to 195 (124 residues), 118.8 bits, see alignment E=7.4e-39 amino acids 275 to 395 (121 residues), 87.7 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 60% identical to GSPF_VIBCH: Type II secretion system protein F (epsF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 100% identity to ect:ECIAI39_3454)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>HEPCGN_18060 general secretion pathway protein F (Escherichia coli ECOR38)
MALFYYQALERNGRKTKGMIEADSARHARQLLRGKELIPVHIEARLNASTGGMLQRRRHA
HRRVAAADLALFTRQLATLVQAAMPLETCLQAVSEQSEKLHVKSLGMALRSRIQEGYTLS
DSLREHPRVFDSLFCSMVAAGEKSGHLDVVLNRLADYTEQRQHLKSRLLQAMLYPLVLLV
VATGVVTILLTAVVPKIIEQFDHLGHALPASTRMLIAMSDTLQTSGVYWLAGLLGLLVLG
QRLLKNPAMRLRWDKTLLRLPVTGRVARGLNTARFSRTLSILTASSVPLLEGIQTAAAVS
ANRYVEQQLLLAADRVREGSSLRAALAELRLFPPMMLYMIASGEQSGELETMLEQAAVNQ
EREFDTQVGLALGLFEPALVVMMAGVVLFIVIAILEPMLQLNNMVGM