Protein Info for HEPCGN_17855 in Escherichia coli ECOR38

Name: dLH
Annotation: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF01738: DLH" amino acids 85 to 293 (209 residues), 168.8 bits, see alignment E=2.6e-53 PF02129: Peptidase_S15" amino acids 159 to 211 (53 residues), 26.6 bits, see alignment 9.7e-10 PF08840: BAAT_C" amino acids 163 to 223 (61 residues), 21.2 bits, see alignment E=5.7e-08

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 97% identity to ecq:ECED1_3650)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>HEPCGN_17855 dienelactone hydrolase (Escherichia coli ECOR38)
MPRLTAKDFPQELLDYYDYYAHGKISKREFLNLAAKYAVGGMTALALFDLLKPNYALATQ
VEFTDPEIVAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAVVVVHENRGLNPYIEDVARR
VAKAGYIALAPDGLSSVGGYPGNDDKGRKLQQQVDPTKLMNDFFAAIEFMQSYPQATGKV
GITGFCYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKIEAPLLLHYAELDTRINEGW
PAYEAALKANNKVYEAYIYPGVNHGFHNDSTPRYDKSAADLAWQRTLKWFDKYLS