Protein Info for HEPCGN_17755 in Escherichia coli ECOR38

Name: mqsR
Annotation: type II toxin-antitoxin system toxin MqsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF15723: MqsR_toxin" amino acids 5 to 97 (93 residues), 119.4 bits, see alignment E=3.7e-39

Best Hits

Swiss-Prot: 99% identical to MQSR_ECOLI: mRNA interferase toxin MqsR (mqsR) from Escherichia coli (strain K12)

KEGG orthology group: K13651, motility quorum-sensing regulator / GCU-specific mRNA interferase toxin (inferred from 99% identity to eco:b3022)

MetaCyc: 99% identical to mRNA interferase toxin MqsR (Escherichia coli K-12 substr. MG1655)
3.1.26.-

Predicted SEED Role

"Toxin mRNA interferase YgiU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (98 amino acids)

>HEPCGN_17755 type II toxin-antitoxin system toxin MqsR (Escherichia coli ECOR38)
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTT
YSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK