Protein Info for HEPCGN_17550 in Escherichia coli ECOR38

Name: plsY
Annotation: glycerol-3-phosphate 1-O-acyltransferase PlsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 49 to 74 (26 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 1 to 195 (195 residues), 275 bits, see alignment E=1.8e-86 PF02660: G3P_acyltransf" amino acids 11 to 184 (174 residues), 180.9 bits, see alignment E=1e-57

Best Hits

Swiss-Prot: 100% identical to PLSY_SHISS: Glycerol-3-phosphate acyltransferase (plsY) from Shigella sonnei (strain Ss046)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to eco:b3059)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>HEPCGN_17550 glycerol-3-phosphate 1-O-acyltransferase PlsY (Escherichia coli ECOR38)
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI
FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW
DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN
IQRLWRRQETKIWTKFKRKREKDPE