Protein Info for HEPCGN_17315 in Escherichia coli ECOR38

Name: yqjE
Annotation: Inner membrane protein YqjE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 50 to 76 (27 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details PF07332: Phage_holin_3_6" amino acids 19 to 127 (109 residues), 75.6 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 100% identical to YQJE_SHIFL: Inner membrane protein YqjE (yqjE) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b3099)

Predicted SEED Role

"Inner membrane protein YqjE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>HEPCGN_17315 Inner membrane protein YqjE (Escherichia coli ECOR38)
MADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVELEEEKANLFQLLLMLGLTMLF
AAFGLMSLMVLIIWAVDPQYRLNAMIATTVVLLLLALIGGIWTLRKSRKSTLLRHTRHEL
ANDRQLLEEESREQ