Protein Info for HEPCGN_17140 in Escherichia coli ECOR38

Name: agaS
Annotation: D-galactosamine-6-phosphate deaminase AgaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 56 to 75 (20 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details TIGR02815: putative sugar isomerase, AgaS family" amino acids 13 to 382 (370 residues), 629 bits, see alignment E=1.2e-193 PF01380: SIS" amino acids 49 to 187 (139 residues), 75.2 bits, see alignment E=2.2e-25 amino acids 222 to 357 (136 residues), 63.9 bits, see alignment E=6.8e-22

Best Hits

Swiss-Prot: 98% identical to AGAS_ECOLI: Putative D-galactosamine-6-phosphate deaminase AgaS (agaS) from Escherichia coli (strain K12)

KEGG orthology group: K02082, tagatose-6-phosphate ketose/aldose isomerase [EC: 5.-.-.-] (inferred from 98% identity to eco:b3136)

MetaCyc: 97% identical to D-galactosamine-6-phosphate deaminase/isomerase (Escherichia coli O157:H7)
3.5.99.-

Predicted SEED Role

"Galactosamine-6-phosphate isomerase (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>HEPCGN_17140 D-galactosamine-6-phosphate deaminase AgaS (Escherichia coli ECOR38)
MPENYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRKENLRVILTG
AGTSAFIGDIIAPWLASHTGKNFSAVPTTDLVTNPMDYLNPAHPLLLISFGRSGNSPESV
AAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLMPAETHDRGFAMTSSITTMM
ASCLAVFAPETINSQTFRDVADRCQEILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAAR
ESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDNETLVVVFVSSHPYTRQYDLDLLAELR
RDNQALRVIAIAAESNDVITAGPHIILPPSRHFIDVEQAFCFLMYAQTFALMQSLHMGNT
PDTPSASGTVNRVVQGVIIHPWQA