Protein Info for HEPCGN_17125 in Escherichia coli ECOR38

Name: agaC
Annotation: PTS galactosamine transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 30 to 31 (2 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 177 to 202 (26 residues), see Phobius details amino acids 209 to 238 (30 residues), see Phobius details TIGR00822: PTS system, mannose/fructose/sorbose family, IIC component" amino acids 2 to 267 (266 residues), 408.8 bits, see alignment E=4.7e-127 PF03609: EII-Sor" amino acids 7 to 237 (231 residues), 228.9 bits, see alignment E=3.1e-72

Best Hits

Swiss-Prot: 100% identical to PTPC1_ECOLI: N-acetylgalactosamine permease IIC component 1 (agaC) from Escherichia coli (strain K12)

KEGG orthology group: K10985, PTS system, galactosamine-specific IIC component (inferred from 100% identity to eco:b3139)

Predicted SEED Role

"PTS system, galactosamine-specific IIC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>HEPCGN_17125 PTS galactosamine transporter subunit IIC (Escherichia coli ECOR38)
MHEITLLQGLSLAALVFFLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELA
FAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSL
FMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTH
GFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVYEF
FNAKSRQQAQPQPVASKNEEEDYSNGI