Protein Info for HEPCGN_17100 in Escherichia coli ECOR38

Name: yraN
Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00252: TIGR00252 family protein" amino acids 10 to 131 (122 residues), 199.7 bits, see alignment E=6.2e-64 PF02021: UPF0102" amino acids 24 to 114 (91 residues), 88.1 bits, see alignment E=2.1e-29

Best Hits

Swiss-Prot: 99% identical to YRAN_SHISS: UPF0102 protein YraN (yraN) from Shigella sonnei (strain Ss046)

KEGG orthology group: K07460, putative endonuclease (inferred from 98% identity to eco:b3148)

Predicted SEED Role

"Endonuclease (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>HEPCGN_17100 YraN family protein (Escherichia coli ECOR38)
MATVPTRSGSPRQLTTKQTGDAWEAQARRWLKGKGLRFIAANVNERGGEIDLIMREGRTT
VFVEVRYRRSALYGGAAASVTRSKQHKLLQTARLWLARHNGSFDTVDCRFDVVAFTGNEV
EWIKDAFNDHS