Protein Info for HEPCGN_17075 in Escherichia coli ECOR38

Name: yhbO
Annotation: protein/nucleic acid deglycase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF01965: DJ-1_PfpI" amino acids 3 to 168 (166 residues), 193 bits, see alignment E=1.7e-61 TIGR01382: intracellular protease, PfpI family" amino acids 4 to 171 (168 residues), 231.1 bits, see alignment E=2.8e-73

Best Hits

Swiss-Prot: 99% identical to YHBO_ECOLI: Protein/nucleic acid deglycase 2 (yhbO) from Escherichia coli (strain K12)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 99% identity to eco:b3153)

MetaCyc: 99% identical to protein/nucleic acid deglycase 2 (Escherichia coli K-12 substr. MG1655)
GLYOXIII-RXN [EC: 4.2.1.130]; RXN-17632 [EC: 4.2.1.130, 3.5.1.124]

Predicted SEED Role

"General stress protein 18"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.5.1.124 or 4.2.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>HEPCGN_17075 protein/nucleic acid deglycase (Escherichia coli ECOR38)
MSKKIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDE
VTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRK
LTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTPDDLPAFNREALRLLGA