Protein Info for HEPCGN_16545 in Escherichia coli ECOR38

Name: xylG
Annotation: D-xylose ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF00005: ABC_tran" amino acids 21 to 170 (150 residues), 111 bits, see alignment E=7.2e-36 amino acids 274 to 427 (154 residues), 71.3 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 44% identical to RBSA_SALTY: Ribose import ATP-binding protein RbsA (rbsA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 99% identity to sbo:SBO_3126)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>HEPCGN_16545 D-xylose ABC transporter ATP-binding protein (Escherichia coli ECOR38)
MTDVILDVSHIAKTFGHVQALKNITLSLRKGRVHTLLGENGAGKSTLMKILAGVYPPTQG
TITLRGETITINNPQHSRQLGIAIIFQELSLSNNMTVAENIYANNEPRRFGIINDKKMLA
DCQNLLAELGIPLDPLEMVGNMSMAHRQLVEIAKALSYAADVVIMDEPTSSLSDNEAEIL
FNIIEKLKQRGCAVIYISHRMDEIMRISDDISVIRDGEYIATHEKKNSDIQHLIAQMVGR
EMKNIWPARLGEKPDENVPAKLEVKNLSHPSLFKEVSFAVRPGEVLGFFGLVGAGRSDVM
KALFGLVSYHGTVLIDGKEVRIANPKQAIDHGIAFVTENRKEEGLVLMHDVNMNTHHVAF
QYNASRIGLINHRQEEAKTLQSIARMNTKVSSVHQAVGALSGGNQQKIVLSKWLEKTPRI
LLLDEPTRGVDVGAKFEIYNVIRQLAAAGTAIILVSSELPEVMALSDRLVVMRNKTIADI
YSCENLTQTQVMTAATGVR