Protein Info for HEPCGN_16380 in Escherichia coli ECOR38

Name: tsaC
Annotation: L-threonylcarbamoyladenylate synthase type 1 TsaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF01300: Sua5_yciO_yrdC" amino acids 16 to 190 (175 residues), 159.1 bits, see alignment E=4.1e-51

Best Hits

Swiss-Prot: 99% identical to TSAC_ECO24: Threonylcarbamoyl-AMP synthase (tsaC) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K07566, putative translation factor (inferred from 98% identity to ecd:ECDH10B_3457)

MetaCyc: 98% identical to L-threonylcarbamoyladenylate synthase (Escherichia coli K-12 substr. MG1655)
RXN-14569 [EC: 2.7.7.87]

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>HEPCGN_16380 L-threonylcarbamoyladenylate synthase type 1 TsaC (Escherichia coli ECOR38)
VNNNLQGDSIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLIL
IAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTD
HPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFGAAFPVVPGETGGRLNPSEIRD
ALTGELFRQG