Protein Info for HEPCGN_15415 in Escherichia coli ECOR38
Name: ptsH
Annotation: HPr family phosphocarrier protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to PTHP_BACHD: Phosphocarrier protein HPr (ptsH) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
KEGG orthology group: K11189, phosphocarrier protein (inferred from 96% identity to ece:Z4879)MetaCyc: 32% identical to phosphocarrier protein HPr (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Phosphotransferase system HPr enzyme in cluster with fructose-bisphosphate aldolase"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (89 amino acids)
>HEPCGN_15415 HPr family phosphocarrier protein (Escherichia coli ECOR38) MLSKTVEVRNSTGLHARPAACLAKAAKKYSCKVTLHYEGNDINATSMMNIMRAGIKGGKT VEIRCEGDDENEAIQTLTTLFRDRFGEAE