Protein Info for HEPCGN_15295 in Escherichia coli ECOR38

Name: arsR
Annotation: As(III)-sensing metalloregulatory transcriptional repressor ArsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF12840: HTH_20" amino acids 13 to 60 (48 residues), 32 bits, see alignment E=9.7e-12 PF01022: HTH_5" amino acids 15 to 60 (46 residues), 61.9 bits, see alignment E=4.3e-21

Best Hits

Swiss-Prot: 97% identical to ARSR_ECOLI: Arsenical resistance operon repressor (arsR) from Escherichia coli (strain K12)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 97% identity to eco:b3501)

MetaCyc: 97% identical to DNA-binding transcriptional repressor ArsR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>HEPCGN_15295 As(III)-sensing metalloregulatory transcriptional repressor ArsR (Escherichia coli ECOR38)
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLL
LDRKQGKWVHYRLSPHIPAWAAKIIEQAWRCEQEKVQVIVRNLARQNCSADSKNICS