Protein Info for HEPCGN_15275 in Escherichia coli ECOR38

Name: yraQ
Annotation: Uncharacterized membrane protein YraQ, UPF0718 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 268 to 275 (8 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details PF03773: ArsP_1" amino acids 9 to 330 (322 residues), 179.5 bits, see alignment E=4.3e-57

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to ect:ECIAI39_3997)

Predicted SEED Role

"FIG00639112: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>HEPCGN_15275 Uncharacterized membrane protein YraQ, UPF0718 family (Escherichia coli ECOR38)
MSSWLAMLQDAAEMFVFLAVELSLLFIVISAGVSLIRQKVPDHKIQQMMGARKGRGYLLA
ALLGAVTPFCSCSTIPMLRGLLSAKAGFGPTLTFLFVSPLLNPIIVGLMWVTFGWKVTLL
YAIIAAGVSVLASIILDSLGFERHIIASKSSSANCCAPAKTSPGTTYTPIKVSCCSPAAK
AIEKPVVNCCSTKAVVSINPIKLATKDALQQFKDVLPYLLLGVLIGSFIYGFIPSEWIAA
HAGADNPFAIPLSAVVGIPLYIRAEAVIPLASVLMTKGMGLGALMALIIDSAGASLTEVI
LLKSMFRIPMIVAFLTIILGMAILMGYLTQMLF