Protein Info for HEPCGN_14775 in Escherichia coli ECOR38

Name: yiaM
Annotation: 2,3-diketo-L-gulonate TRAP transporter small permease YiaM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04290: DctQ
  • amino acids 1 to 126 (126 residues), 103.3 bits, E=4.7e-34

Best Hits

Swiss-Prot: 100% identical to YIAM_ECOLI: 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM (yiaM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3577)

MetaCyc: 100% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"2,3-diketo-L-gulonate TRAP transporter small permease protein yiaM"

Protein Sequence (138 amino acids)

>HEPCGN_14775 2,3-diketo-L-gulonate TRAP transporter small permease YiaM (Escherichia coli ECOR38)
VFINIILRYGFQTSILSVDELSRYLFVWLTFIGAIVAFMDNAHVQVTFLVEKLSPAWQRR
VALVTHSLILFICGALAWGATLKTIQDWSDYSPILGLPIGLMYAACLPTSLVIAFFELRH
LYQLITRSNSLTSPPQGA