Protein Info for HEPCGN_14680 in Escherichia coli ECOR38

Name: selA
Annotation: L-seryl-tRNA(Sec) selenium transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF12390: Se-cys_synth_N" amino acids 9 to 48 (40 residues), 41.6 bits, see alignment 1.1e-14 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 10 to 460 (451 residues), 632.7 bits, see alignment E=1.8e-194 PF03841: SelA" amino acids 83 to 451 (369 residues), 606 bits, see alignment E=2.6e-186

Best Hits

Swiss-Prot: 100% identical to SELA_ECO7I: L-seryl-tRNA(Sec) selenium transferase (selA) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 99% identity to eco:b3591)

MetaCyc: 99% identical to selenocysteine synthase (Escherichia coli K-12 substr. MG1655)
L-seryl-tRNA(Sec) selenium transferase. [EC: 2.9.1.1]

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>HEPCGN_14680 L-seryl-tRNA(Sec) selenium transferase (Escherichia coli ECOR38)
MTTETRSLYSQLPAIDRLLRDSSFLSLRDTYGHTRVVELLRQMLDEAREVIRDSQTLPAW
CENWAQEVDARLTKEAQSALRPVINLTGTVLHTNLGRALQAEAAVEAVTKAMRSPVTLEY
DLDDAGRGHRDRALAQLLCRITGAEDACIVNNNAAAVLLMLAATASGKEVVVSRGELVEI
GGAFRIPDVMRQAGCTLHEVGTTNRTHANDYRQAVNENTALLMKVHTSNYSIQGFTKAID
EAELVALGKELDIPVVTDLGSGSLVDLSQYGLPKEPMPQELIAAGVSLVSFSGDKLLGGP
QAGIIVGKKEMIARLQSHPLKRALRADKMTLAALEATLRLYLHPEALSKKLPTLRLLTRS
AEVIQIQAQRLQAPLAAHYGAEFAVQVMPCLSQIGSGSLPVDRLPSAALTFTPHDGRGSH
LESLAARWRELPVPVIGRIYDGRLWLDLRCLEDEQRFLEMLLK