Protein Info for HEPCGN_14330 in Escherichia coli ECOR38

Annotation: aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01116: F_bP_aldolase" amino acids 4 to 282 (279 residues), 253.6 bits, see alignment E=1.4e-79

Best Hits

Swiss-Prot: 38% identical to KBAY_ECO7I: D-tagatose-1,6-bisphosphate aldolase subunit KbaY (kbaY) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 99% identity to ecz:ECS88_4075)

MetaCyc: 38% identical to D-tagatose-1,6-bisphosphate aldolase subunit KbaY (Escherichia coli O157:H7)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

"Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40)" in subsystem D-Tagatose and Galactitol Utilization or Lactose and Galactose Uptake and Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 4.1.2.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13, 4.1.2.40

Use Curated BLAST to search for 4.1.2.13 or 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>HEPCGN_14330 aldolase (Escherichia coli ECOR38)
MFADMKSMVMKAWHEHYALLAINCMNLESAHAAIRVAEKNRAPIILNLYQGHLAHFPAPV
AAAVVKTLAESASVPVALALDHGKNPDCIRQAFRAGFSGLMIDASAFPLEENVRQTRAVV
ELAASVQLCVEGELGHLADAPRYDQAANADLMTQPTDVEPFIAQTGIDLLAVSVGTAHGM
YAPGVVPAIDFQRLAEIFHCSSVPLALHGGSGTPFDQLQLCTTLGVAKINVGAAIFERGK
SALLHTLCHDISIELVDALKAMELAFEEAITPYLQASGSIGKA