Protein Info for HEPCGN_14290 in Escherichia coli ECOR38

Name: fimB
Annotation: integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF13356: Arm-DNA-bind_3" amino acids 3 to 88 (86 residues), 103.7 bits, see alignment E=9.5e-34 PF22022: Phage_int_M" amino acids 100 to 194 (95 residues), 122.5 bits, see alignment E=1.4e-39 PF00589: Phage_integrase" amino acids 206 to 370 (165 residues), 97.3 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 49% identical to VINT_BPSFV: Integrase (int) from Shigella phage Sf6

KEGG orthology group: None (inferred from 100% identity to ssn:SSON_3744)

Predicted SEED Role

"Phage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>HEPCGN_14290 integrase (Escherichia coli ECOR38)
MALTDIKVKTAKPKDKPYKLADGGGMYLLINTNGSKYWRMKYRFAGKEKMLSIGVYPDVT
LADAREKRSEARKLLAAGGDPGEAKKEEKIAQQISLKNTFEAIAREWHQSKADRWSLRYR
DEIIDTFEKDIFPYIGKRPIAEIKPMELLEALRKMEKRGALEKMRKVRQRCGEVFRYAIV
TGRADYNPAPDLASALATPKKVHFPFLTANELPHFLNDLAGYTGSIITKTATQIIMLTGV
RTQELRFARWEDIDFETKLWEIPAEVMKMKRPHIVPLSEQVIMLFKQLEPISKHHPLVFI
GRNDPRKPISKESINQVIELLGYKGRLTGHGFRHTMSTILHEQGFNSAWIEMQLAHVDKN
SIRGTYNHALYLDGRREMMQWYADYIDSLSSRES